PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G050100.1.p
Common NameGLYMA_12G050100, LOC100793770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 972aa    MW: 107667 Da    PI: 6.3922
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G050100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.9e-29600650252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Glyma.12G050100.1.p 600 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 650
                          79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.234582670IPR003035RWP-RK domain
PfamPF020422.5E-26602650IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.3E-22868950No hitNo description
SuperFamilySSF542771.8E-21868955No hitNo description
PROSITE profilePS5174521.363871953IPR000270PB1 domain
SMARTSM006662.1E-21871953IPR000270PB1 domain
CDDcd064071.15E-29872952No hitNo description
PfamPF005644.0E-16874952IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MEDHVSPEGK EVSCCAPPGA QLEESTSVDG GKKNSSSEDM FSNFSELMNF DTYAGWSNSP  60
SMTDLSVANV FSLFSSAPYP PPDGLNLVEQ SNGSFFMTED SEFHNGMESS PSCVERVIFQ  120
QMDIHLGFLD EANDSNNLDS KEKLNGKSQQ VNTSDMCNYI ISRSPGRSLD DRMLRALSFF  180
MESADEGMLA QVWVPTKHGD EFILSTSQQP YLLDPKLAGY REVSRAFTFS AEGKTRTCPG  240
LPARVFISHV PEWTSNVGYY NKTEYLRLEH AKNHEIRGSI ALPISDVHSQ VPCAVLELVT  300
TKEKANFDRE LEIFSHALQL VNLRTSMPPR LLPQCLSSNK RVALTEIIDV LRAMCHAHRL  360
PLALTWIPCC YSEGIRDETE RIRIKEGHTS SNEKCVLCIE ESACYVNDGG VGGFVHACIE  420
HHLEEGQGIA GKALQSNHPF FYTDVKTYDI GEYPLVHHAR KYNLNAAVAI RLRSTYTNGD  480
DYILEFFLPV NMTGSSEQQL LLDNLSGTMR RICKSLRTVS DAELTGIDGS QGGFPKEKVS  540
GFFPMSRRNS EIAFINGDHD SVQKMSMKTS NMRNNGTEAV HSQAMNGSRK QVEKKRSTVE  600
KNVSLSVLQQ YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLKKIQTV  660
LDSVQGVEGG LKFDPYTGGF IAGGSIMQEI DAHKYLVFPK KSSVKDPKPA TQKTVSVAPA  720
PGSTRENSTI KLNDDESVCL VRNKFVHSRN VLNSNSSKGE LKKDNVSSDD CCDDSKSMAM  780
NDGSCQKSCL WTKTQDCPEQ TCSISLVTDE VEVGVDRVEG ADEHNHPTSS STTHSSNGSG  840
SMMHGSSSCS QSFEKQKHSK VKSNCVDSGS KMIVKASYRG DTIRFKFDPS SGCFQLYEEV  900
ATRFKLQNGS FQLKYLDDEE EWVMLVNDSD LQECTEILGD IGTRFVKFLV RDVPCVFRSR  960
GSNSCFLSDS S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351720.0AC235172.1 Glycine max strain Williams 82 clone GM_WBb0002N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592131.10.0PREDICTED: protein NLP9-like
RefseqXP_014619984.10.0PREDICTED: protein NLP9-like
RefseqXP_014619985.10.0PREDICTED: protein NLP9-like
RefseqXP_014619986.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLI1LQB50.0I1LQB5_SOYBN; Uncharacterized protein
STRINGGLYMA12G05390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein